PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf13522g01013.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 317aa    MW: 34156.6 Da    PI: 9.0759
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf13522g01013.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.84.9e-3869128362
                    zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                               e+ lkcprCds+ntkfCy+nny+l+qPr+fCk+CrryWt+GGalr vPvGgg+r+nk+s+
  Niben101Scf13522g01013.1  69 EAGLKCPRCDSSNTKFCYFNNYNLAQPRHFCKSCRRYWTRGGALRSVPVGGGCRRNKRSK 128
                               6779*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-3652121IPR003851Zinc finger, Dof-type
PfamPF027015.2E-3271126IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.47872126IPR003851Zinc finger, Dof-type
PROSITE patternPS01361074110IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MSFSSFPVYL DHPNLQQLQQ LDHHQGNPGL ENSQLPTVAP HAQVGGSPGS IRPGSMVDRA  60
RLAKIPLPEA GLKCPRCDSS NTKFCYFNNY NLAQPRHFCK SCRRYWTRGG ALRSVPVGGG  120
CRRNKRSKST NTSSRTAGNN NTGERQIGTT STSTSASPSS CSKEITGQHF SQSSTHLTPL  180
MAAFQNLNHQ YGGFQPPPLV STQNNGGLGH EMGFQIGSNS TNNLQAAATG GSDNHHHHQW  240
TLPSLAATNL YPFQGEGIEA TSSGISHQDS VVRMEENNQG LNSTKQFLGT MENNQYWGGN  300
AWTGFSGLNS SSAGHLL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00407DAPTransfer from AT3G55370Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016444808.10.0PREDICTED: dof zinc finger protein DOF2.4-like
TrEMBLQ9M4G11e-122Q9M4G1_SOLTU; Dof zinc finger protein
STRINGPGSC0003DMT4000781641e-119(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.12e-42Dof family protein